PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00435.1.g00460.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 222aa    MW: 23524 Da    PI: 7.6166
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00435.1.g00460.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.91.6e-31135193159
                                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg Hnh 
  Zpz_sc00435.1.g00460.1.sm.mkhc 135 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDKDDPSFVVTTYEGMHNHV 193
                                     59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-34121195IPR003657WRKY domain
SuperFamilySSF1182902.75E-28127195IPR003657WRKY domain
PROSITE profilePS5081131.686130195IPR003657WRKY domain
SMARTSM007745.7E-36135194IPR003657WRKY domain
PfamPF031064.8E-25136192IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAAVGARPVL YHLPAPSGDA ALSMSSYFSH GGSSTSSSAS SFSAALAPAP QQPQPLRADP  60
AAQFDISEFF DDVAQGVFAA PPAVDAPPPV VPADSGAVAA GGAGTHNARS AAEALPERPR  120
TERIAFRTRS EIEILDDGYK WRKYGKKSVK NSPNPRNYYR CSTEGCNVKK RVERDKDDPS  180
FVVTTYEGMH NHVSPSTVYY ASQDAASGRF FVAGTQPPGS QN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-27125196778Probable WRKY transcription factor 4
2lex_A8e-27125196778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0993671e-155FP099367.1 Phyllostachys edulis cDNA clone: bphylf033k16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440147.12e-93hypothetical protein SORBIDRAFT_09g026830
SwissprotQ93WU93e-44WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLC5YUJ22e-93C5YUJ2_SORBI; Putative uncharacterized protein Sb09g026830
STRINGSb09g026830.15e-93(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-41WRKY DNA-binding protein 51